SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027010m|PACid:19706479 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027010m|PACid:19706479
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily F-box domain 0.000000000436
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027010m|PACid:19706479
Sequence length 127
Sequence
MEDIRLPADVLLSVISRAAAGPRDACIVATVSPAFRAAADSDTVWSRFLPADFAPLVYPA
PPPRSKKELFLRLSGNHALLEDGLTSAWLDRETGAKCYMVAARAMRIIWVDTPDYWRWIP
REDSRFA
Download sequence
Identical sequences K3ZKA4
Si027010m|PACid:19706479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]