SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027264m|PACid:19708340 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027264m|PACid:19708340
Domain Number 1 Region: 123-421
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000667
Family Cyclin A/CDK2-associated p19, Skp2 0.061
Further Details:      
 
Weak hits

Sequence:  Si027264m|PACid:19708340
Domain Number - Region: 46-94
Classification Level Classification E-value
Superfamily F-box domain 0.00265
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027264m|PACid:19708340
Sequence length 491
Sequence
MEEIQTSSPCSWQPRRLRRRPRANTTDETNGGAPCTAHQPLQANEAASQGTVPELPEDAL
QHIHSLMTMRDAACVSRRFLFFWRRYPNLAFNQEYISGYRGKYVFSKAQYVLENHSGVGV
KMLKLNLSTCSKKDIDINLLDGWLRAFIKPGITELAFLHLASCDFHPTEGPRLLGCSRSL
STVCLHNVRITGDEVGFFLSSCFALERLDLSKCSMITSLKIPRVLHKLRIVQLHMCQVLQ
TVEINALNLSPFNYNGCPLSSFSLGDSLETKELLMHVVGMPDLIQYVGCNVPSIAPNLEM
LMLSTVNEKLKAPAIFDKFQHLKHLVICLGKRGEFFKGYDFFSLAHFLDACVALETFTLR
IQIGCRWYDMQSRVAIMPFRHGGLRSLRKATITGFCSSKSLVELTCHILRSAASSLQFIL
LDTSRGYDWKHSLTDRCRTMGTMDLQDSERALFNIRQYVEPKVPPGVELKVLGPCSRCHS
IDAKAMEEATS
Download sequence
Identical sequences K3ZL08
Si027264m|PACid:19708340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]