SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027270m|PACid:19708279 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027270m|PACid:19708279
Domain Number 1 Region: 68-129
Classification Level Classification E-value
Superfamily F-box domain 0.000000000144
Family F-box domain 0.0042
Further Details:      
 
Weak hits

Sequence:  Si027270m|PACid:19708279
Domain Number - Region: 146-181
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0116
Family Type II chitinase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027270m|PACid:19708279
Sequence length 184
Sequence
MAGPLVPVGDTNHRLRSPSRGAAPPPACRGSAPPPALARRRAVPLPVLHPPSPIFSAAAT
TIQNLAHSPSSPPPPPRGWVALLRDVLVAVFRKLDHVEILMGTGRVCRSWCHAARDDPAL
WRRIDMRGHADLHRRVGLCGMARAAIHRAVIPLVQETPNYGGVIMWNRYDDKRDRYGLRI
KLMV
Download sequence
Identical sequences K3ZL14
Si027270m|PACid:19708279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]