SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027273m|PACid:19708841 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027273m|PACid:19708841
Domain Number 1 Region: 7-59
Classification Level Classification E-value
Superfamily F-box domain 0.0000000563
Family F-box domain 0.0071
Further Details:      
 
Domain Number 2 Region: 124-225,289-304
Classification Level Classification E-value
Superfamily RNI-like 0.0000526
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027273m|PACid:19708841
Sequence length 416
Sequence
MQAETGSEDRISALRNEILQYVISFLPAQEAVQTCVLAKGWCHLWKSMPVLRIIADEWQD
EQGVKKMNMFMKNLLLKRNGSAPVDVREVRIGEYVDAEGDPQVDLLIRNALLRQARIIRV
TLTSEYNWAELGGLPFISQHLTWLELTHVELRGDVLDYSSCPALKNLFMRGCYIFHSRKI
SSQSLEELTIIDCTFHPYHRTRISAPSLVRLELADFDACIKATIRLYGSKDVCGKEFGGT
CSTVGCHNCGTLSNEDFNRHSILIKGLSKAESLELEAECTAVFYFQRDLLWCPTFSKLKT
LVLNEWCVAINSRPLTCVLQHTPVPDNWDEMEGSYDPLAQPIASKKLKVVKVHYDELDGR
VHNIVRIMKSHLGIEEVNGEESFQIFYANWELMHSTGLPFFGQGHKKVKLNYDLHR
Download sequence
Identical sequences K3ZL17
Si027273m|PACid:19708841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]