SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027279m|PACid:19706529 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027279m|PACid:19706529
Domain Number 1 Region: 298-610
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 5.36e-40
Family Galactose oxidase, central domain 0.019
Further Details:      
 
Domain Number 2 Region: 60-169
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.27e-19
Family Flavin-binding PAS domain 0.0015
Further Details:      
 
Domain Number 3 Region: 207-270
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000549
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027279m|PACid:19706529
Sequence length 625
Sequence
GSVAVKRTRLWEVEAEVEGEEGMEVDGEEEEEEEEEEGWAWGAPAAGVGVGVGMGEQRAA
AIVVADAAEADFPVIYVNAAFEAATGYRAHEVLGRNCRFLQFRDPRAQRRHPLVDPMVVS
EIRRCLNEGIEFQGELLNFRKDGAPLYNRLRLIPMHGDDGSVTHVIGIQLFSEANIDLSN
ISYPVYKQQSNHRPTIQDLNSASHEHTPKIQSSDYCGILQLSDEVLAHNILSRLSPRDVA
SIGSVCTRMHELTKNDHLRKMVCQNAWGRDVTVKLEMSTKMLRWGRLARELTTLEAASWR
KFTVGGRVEPSRCNFSACAVGNRLVLFGGEGVNMQPMDDTFVLNLEAPTPEWRRVKVSAS
PPGRWGHTLSWLNGSWLVVFGGCGQRGLLNDVFVLDLDAQQPTWREVASEGPPLPRSWHS
SCTLDGSKLVVSGGCTESGVLLSDTFLLDLTKEKPAWREIPTSWSPPSRLGHTMSVYGTT
KLFMYGGLAKSGSLRLRSSDAYTLDVGEDSPQWRQLATTGFPNVGPPPRLDHVAVSLPCG
RIIIFGGSIAGLHSPAQLFLIDPAEEKPAWRILNVPGQPPKFAWGHSTCVVGGTRVLVLG
GHTGEEWILNELHELCLASRPDEDE
Download sequence
Identical sequences K3ZL23
Si027279m|PACid:19706529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]