SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027284m|PACid:19708383 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027284m|PACid:19708383
Domain Number 1 Region: 20-72
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000327
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 159-269
Classification Level Classification E-value
Superfamily RNI-like 0.00000445
Family 28-residue LRR 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027284m|PACid:19708383
Sequence length 274
Sequence
MKQALRGTAIPGSSSQKSAPDRISALPDELLLHVMYFLTLQEAAQTSLLSRRWQNLWASL
MWLNFDAAKFSSMRTYRKFVNNALLIRSSLPVPVPLDAFWISAECDNSDDSLDYSDMHPW
IRHALNSKAWAIGILKHSGPKPLSMQGYPFPFTSVYSKILGLCHCSIDDWVVPKVLQHDL
LSCETFSNLEQLHLGEWFSSPGCYPLICLLRRSPGIKKLILLARKQITNFSCKELREISI
HCDPRSDKRAQIITRILSAHLCPLSEIKIWPITT
Download sequence
Identical sequences K3ZL28
Si027284m|PACid:19708383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]