SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027326m|PACid:19708184 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027326m|PACid:19708184
Domain Number 1 Region: 197-385
Classification Level Classification E-value
Superfamily L domain-like 0.00000102
Family Ngr ectodomain-like 0.064
Further Details:      
 
Weak hits

Sequence:  Si027326m|PACid:19708184
Domain Number - Region: 2-63
Classification Level Classification E-value
Superfamily F-box domain 0.0105
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027326m|PACid:19708184
Sequence length 417
Sequence
ARQVVQTCVLSKRWRHLLRSVPCLDVDHDEFKKTARASEDGSYSSGDHSSDSNDDQWRHH
WRRPWLGVGLGVDRNVFNTVIASDDNSDSLGDDNSDSDDDIHDSDDDTPDSDSDSDGDCS
GSNLGSSDANVDDDNHKDKEKDKDWEDFEDFTANLMLRCNIAQLDSFRLHIIGSRAPEFG
DRQAADGSHVGLSSGSWCLKRLHLCHVILDNHFVKHVRSVCHSLEDLDLDDCTCKIRSIT
SHSLKTLILKNCRWCNLSKITSTTLKTLVIDGSSNTDDCVLVILAPAVAYLHLAVNVDHF
CGGISITRYGAFTSRLCGDQFKFLCSISKVTSLELSGVGTKSSPILEKLTLRHCQFPKCP
NKKKGTPILNKISSSVLHGLDLLCENLKVEIIYRHGYGPHLLQLLLRVSVNLSQKKH
Download sequence
Identical sequences K3ZL70
Si027326m|PACid:19708184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]