SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027354m|PACid:19708397 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si027354m|PACid:19708397
Domain Number - Region: 177-213
Classification Level Classification E-value
Superfamily F-box domain 0.000484
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027354m|PACid:19708397
Sequence length 499
Sequence
MDNNAPVLNALHENKRNCRSTLPLLLLPPVSSSATSRTHPWSSVAVCTPDAASARLRCTP
QGCLHLPPSLPAPRTPPAAACAARHLRLLPAPVRHLRLLPAPACHRRRIARSGGAAGMRQ
GEACVLSVKYRNFSCSSDQEAPRRRSVAVMGSGCDRSGVLFDGMPQTRSRSEFDAGVSLW
AGLQPDILGVVLLFLPCLADRARVRSVCRHWPAGAHGHVLPPPLPILVLPGFKFSSLSDR
GELMPVRRVPVPKEMAADDLRCVGSFDGWLLGVTPSKKRSDEYYRDADGDGFLVNVFSRK
VIRLPQLSNPPIINGCCSVHFGANNIYRLSLCQVVLSASPDSGSKYIVAASSNHNACMTE
LPQDHDHPYQGGGAISCNMVVWRGELLLIIRHYTEDFGTRRVLRVEVFALDSEIHSFSGD
CIFVGSAGGCKSFPASLHDGVEGDLIYFVPDDWKPHDTFLYSMRDGTMRPFAAELLACYF
DVPEENLDFPVWLLPLQRW
Download sequence
Identical sequences K3ZL98
Si027354m|PACid:19708397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]