SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027370m|PACid:19708072 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027370m|PACid:19708072
Domain Number 1 Region: 11-78
Classification Level Classification E-value
Superfamily F-box domain 0.000048
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027370m|PACid:19708072
Sequence length 235
Sequence
MVVSEHVMSSSRWHPPSLAVLPTEVAIEITSRLAATSERPMDDLHSLWATCLFMHCVCGD
DAIGRRMALAHFRCNMSWNELASYAALLTRLTLIGNPNAYFLTGIREFFREHRSHQPSLY
ELAHAITGGHNVAAYFVTLLYRNNGSAGDDDTARWFVRWVEGEENSAASNGSGPRMQSNK
GCRLCREKATQMFGPMTPLPLAPVRGDLLCAGGGCGVTFGWPKKTLCCSEGCRMC
Download sequence
Identical sequences K3ZLB4
Si027370m|PACid:19708072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]