SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027420m|PACid:19708605 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027420m|PACid:19708605
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily F-box domain 0.0000327
Family F-box domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027420m|PACid:19708605
Sequence length 245
Sequence
METLPLEVVIEITIHVAATSDQPMDDLCNLRATCRLLHCACSHCAVGRRVALLRCWEDME
WYQPDRYYSLLHLLVGVGNPEASMLRGILDFFGGAGGLPSHPSLDELSRAATGGLNVAAY
LYAVMLYRNVGGTADDDIAKMYVRRVEGEEGTVASGSIGPMKLGNFGCRECRGDAVYLVW
RITWCKAGDALPPAPVHGEFPCAGGGCGFPNGWGQAMLFCSEDCRLRHEIVLVLNNVLPA
YAGLK
Download sequence
Identical sequences K3ZLG2
Si027420m|PACid:19708605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]