SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027496m|PACid:19708828 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027496m|PACid:19708828
Domain Number 1 Region: 64-126
Classification Level Classification E-value
Superfamily F-box domain 0.0000106
Family F-box domain 0.011
Further Details:      
 
Weak hits

Sequence:  Si027496m|PACid:19708828
Domain Number - Region: 300-356
Classification Level Classification E-value
Superfamily YWTD domain 0.0602
Family YWTD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027496m|PACid:19708828
Sequence length 405
Sequence
MASMDSGADNAGGESCLSSSTAYPFEYGCGFQQCRVFLFAGDVFDGTPQNQKRPRFDMGR
EPPPPPPQASTWASVHTDILGVVLNFLPCAADRAAVRSVSRHWRAAARGHCLPPPLLVLV
LPKFRASEFVSHGNGECLLVNAFSDEVIHLPRLKANCNSSINDNDSGFVHTANDKKYGML
LCNNAVLSATPNSGSKCIVAAIFQYTMSARRLALWQAGMTSWYVCRGDCIAWGSDLAFYH
GKLYMIWKYMPYVHAFELGEDEHGVNHNYSLRFQMVVWRGKLLLIIRNFDARKIEPEIVK
VEVFALDISTSRVTEIHSFDGDCIFVDNRGCKSFSAGLHVGVQGDLIYFADGYDGVFSYK
NRLFDAFVCNITDGTIRPLAVEFSPTNSGAPEVHLDIPVWFCPSE
Download sequence
Identical sequences K3ZLN5
Si027496m|PACid:19708828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]