SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027511m|PACid:19708774 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027511m|PACid:19708774
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily F-box domain 0.000000000089
Family F-box domain 0.0075
Further Details:      
 
Domain Number 2 Region: 198-407
Classification Level Classification E-value
Superfamily RNI-like 0.0000463
Family 28-residue LRR 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027511m|PACid:19708774
Sequence length 446
Sequence
MDQDRPHRRRRRRRHRNRSGEDYISGLPDELLHSILLRLGSTRAAARTSVLSRRWRPVWR
HLPELVFGNGSHDAPPPTPASFLDAVDSALAAYAAPTIQGLVIVLSTAAAGLGVPAGRVA
PWLRFAAERVAVELVIFVPPPPMHRHQTWPVVDWEDDLLELPACEEAVLELPACERAKTM
ALRLKQHWRLRLPPAGMFTALTSLTILFASMEGSEVTALVCTRCPCLRNLRLSLTLVDAS
NVSIRSDSLQSLSFCVRKTRRLEVVTPRLENLFVGDYIDEARISAPKLEGIFWRATPYDP
HHHRFDDVGRRLQLLDIGDCFITMASLMQRFDEVHELKLSIPQENRCWSQCPCLQESRSA
NGIALSSLEEVEITSHKSSQEQLLEFVEQLLSRCNAAVLKKLVINYTTFFAPSRTKVACE
KIRRLCHPNTEFEFYEFSYGECVRFY
Download sequence
Identical sequences K3ZLQ0
Si027511m|PACid:19708774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]