SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027522m|PACid:19706785 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si027522m|PACid:19706785
Domain Number - Region: 6-88,167-182
Classification Level Classification E-value
Superfamily F-box domain 0.00392
Family F-box domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027522m|PACid:19706785
Sequence length 241
Sequence
MAANRQQPSLETLPTKLLTVIAIHLATTSDQIMEDLGKLRVTCTVMRRVCGQRAIGRRVA
LLRCWEEMQWNQPGRYYSLIRLLLDVGNPEASLLTGILDFFRGYQPSLDQLSCVAAGGLN
VAVYLYALMLYRNAGGSATADMAKMYIRRLEGEEGTAASGSISPKILHNFICRECREDVV
YLVVRILWNNVALPPAPGRGEFPCDGGGCGFPNGCGEDTLFCSEDYRLRHELAAFERRIV
D
Download sequence
Identical sequences K3ZLR1
Si027522m|PACid:19706785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]