SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027530m|PACid:19706281 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027530m|PACid:19706281
Domain Number 1 Region: 102-291,337-442
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 5.23e-97
Family Transcriptional factor tubby, C-terminal domain 0.00000626
Further Details:      
 
Domain Number 2 Region: 43-96
Classification Level Classification E-value
Superfamily F-box domain 0.00000144
Family F-box domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027530m|PACid:19706281
Sequence length 442
Sequence
MSFRSIVRDVRDGFGSLSRRGFEVRLLGHRRGKSHGAVHELQDPVPVVQSSCWASLPPEL
LRDVIERLEASEDTWPSRKNVVVCAAVCRTWREMCREIVKSPEFSGKITFPVSLKQPGPR
DGTIQCFIKRDKSTQIYYLYLCLSSTVLVENGKFLLSAKRNIRPTCTEYIISMNSGNVSR
STNTNTYIGKLRSNFLGTKFVIYDTQPPYNAASATQSGKTSQRFYSKKASTKVSRSRYSI
AQVSYELNVLGTRGPRRMNCVMHSIPASCLEAGGSVPCQPDSIVAHSLGGSFSSVSLSKS
SVMDHSMHFSSARFSDVATGLGLGSEGRALFDDEECNDRPLILRNKAPRWHEQLQCWCLN
FRGRVTVASVKNFQLVAATQPAAGAPTPSQPAPAPALDQDKVILQFGKVAKDMFTMDYRY
PLSAFQAFAICLSSFDTKLACE
Download sequence
Identical sequences K3ZLR9
Si027530m|PACid:19706281 XP_004978763.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]