SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027559m|PACid:19708489 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027559m|PACid:19708489
Domain Number 1 Region: 180-385
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000863
Family Cyclin A/CDK2-associated p19, Skp2 0.069
Further Details:      
 
Domain Number 2 Region: 25-113
Classification Level Classification E-value
Superfamily F-box domain 0.0000000615
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027559m|PACid:19708489
Sequence length 483
Sequence
MSTNHATTSQETTADQDHDRANPTSINTTVPSVRFCHLPPDILYRIASKLPPKEFARTSV
LSTEWRRCTSLACPRLTFDAVEMFKCEREFMQEIWYRHVVWQFVREVNNILWKHKDKVVE
TLQVRINLEDSILARHIDTWVHFAATSRTKNLTLDLASGRFWEYKNLYEFPFQLLGRESI
SNLQHMHLSYVSFYPPSWFKGFPNLRKLHLEAARFVRKNLEHMLSHCHTLEWLHINRCHL
DELTVDSPLSRLLYLRVERCSFSKIKFNAANLATFEYVGSLIPIDLVHSFKLQSANIEFE
EAIIQHALTSLLHGLPSVQNLTSKFGLPHLEKQWLWDNPLKFSNLRHLQLLLLFIYSENI
DKILYLVSFIRATPFIEKLEVHFNRSDLWLAEVGPCRKDLGQCEYNYLKDIWITGFKAAR
GQVEFLSHVVENAPVLEVVSVKIGKYPRESLSGSGPTIEAAKEIARTCLRTKLSQNVTFN
VEE
Download sequence
Identical sequences K3ZLU7
Si027559m|PACid:19708489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]