SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027562m|PACid:19708584 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027562m|PACid:19708584
Domain Number 1 Region: 8-59
Classification Level Classification E-value
Superfamily F-box domain 0.0000000144
Family F-box domain 0.0087
Further Details:      
 
Weak hits

Sequence:  Si027562m|PACid:19708584
Domain Number - Region: 174-245
Classification Level Classification E-value
Superfamily RNI-like 0.0165
Family 28-residue LRR 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027562m|PACid:19708584
Sequence length 418
Sequence
MGEDRRRCSGSEDRISGLPDELLHAILVRLYSTRAAARSSVLSRRWRHVWAHLPELFLGG
SRDAPPPLASLPDAVDAALAAYSATAAPLERLHITLRRGDGGHPVQASRAASWLRFASRH
VVGELRLFVPAPGVDGEEEEVLELPACHRAKSVRLTIHDSWRLRPQPAGLFAALTSLRID
YGRMEASELTDLVCKRCPQLRDLNLSVDLVDVSDVSVLSGSLQSLLFFVLNIRRLEVVAP
RLEELLVYHASEAHITSPKLAELVWNGEDYDPRLHKFDDVGRHLRLLEIGQISGAASLMR
QFDEVDKLKLQISIPWAHSCPLSCPCRLAESGRVDGIALSFLEEVKLHNFASSSDELEFV
EELSRCNAAVLKKLVINYAYGPATPLTMAICEKVRSMWRPNVSVEFYVFLDGRLVRFD
Download sequence
Identical sequences K3ZLV0
Si027562m|PACid:19708584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]