SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027573m|PACid:19707629 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si027573m|PACid:19707629
Domain Number - Region: 4-65
Classification Level Classification E-value
Superfamily F-box domain 0.000305
Family F-box domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027573m|PACid:19707629
Sequence length 219
Sequence
MASGRQCLMLTDLPMEVLIIVGDVAVTSFKPMEDLSNIRAVCRVMERACSDPSIGQRMAM
LQIYREGLGWRDPDRYYNLLTLLVGVANPQACTLKGIADLFGSTDPSLNELSRATAGGHN
VGAYLYALMLYRKNVGTMNDNIAKMYIRHLECDDDSVAIGSAGPNKLRNDGCWVFREESA
YLVNSVTWRMHGEPLPPAPVCWRYALEAIIEMMIFHLYP
Download sequence
Identical sequences K3ZLW1
Si027573m|PACid:19707629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]