SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027654m|PACid:19708794 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027654m|PACid:19708794
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily F-box domain 0.000000576
Family F-box domain 0.0046
Further Details:      
 
Weak hits

Sequence:  Si027654m|PACid:19708794
Domain Number - Region: 114-333
Classification Level Classification E-value
Superfamily NHL repeat 0.00251
Family NHL repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027654m|PACid:19708794
Sequence length 347
Sequence
MWASLPCDLLVDILRRLDSASAVVRCAGACKPWRRAIIANASRLRPYPDRFNPNLLLGFF
HRRWLDGRHVARLQYVPGPFEDLLSSDVAADTTVPAAAARGGVDAASYDEPLSSRDGFLL
LGGSAAGDLCLCNPLTGSCSFVPNPAATFGPICKYMLVTGDDDSTPGVGVFSCASGEWGP
LRWSAVAEEDDRFRPYLCEEAKDVVVGRDSVVYCLVELMVGFAHDGREHWCVLAVDVRTE
RTWTVQLQERLMALDLRIRCSMIALATSEDGRLSLILKRQGHKIDVWVLIGGDGRWMLRR
TIDVQGFIPYYWPHFWNVRISSFCPRSGCLFGDIDGQDILINLDRGS
Download sequence
Identical sequences K3ZM41
Si027654m|PACid:19708794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]