SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027672m|PACid:19708065 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si027672m|PACid:19708065
Domain Number - Region: 4-70
Classification Level Classification E-value
Superfamily F-box domain 0.000148
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027672m|PACid:19708065
Sequence length 135
Sequence
MASGRQCRLLIDLPMEVLINIAGHVAATSLQPMDDLHNLRVVYRVMHRACGDPSVGRRVA
LLRTYWEDMQWNELDRYYILLALLVGVGNPEACTIKGILSHVAAGGHDVGAYLYTLMMYR
NNGGGADDDIVKMYI
Download sequence
Identical sequences K3ZM59
Si027672m|PACid:19708065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]