SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027682m|PACid:19707815 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027682m|PACid:19707815
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily F-box domain 0.00000144
Family F-box domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027682m|PACid:19707815
Sequence length 384
Sequence
MDRLGRIRPPPSWSNLLPELAGLILRLLLCRIDRLRFSCVCRRWRLAAQQQRPHLPPALP
FICLKALSNYGAFLSLPAGEARRAGAVPAKDVTCHGCFDGWLLYGPHDRDNDDSHKCFLT
NPLTGATVEMPLHLGYLAKSNVLYMLKFMVLSPDLIAALSGSYVAFYRPGAPSWSVSPSD
IGGDRGARGSYYVDSAFYRGKIFALNTEDELFVHEVGAAAADTVEHAIKAQSPQPVDPEE
KFSKKRHYLVVSCTGKLLMVKWTTVPLCCRRPSPRNFDGITVEVFEADLEKGRWLEVSSL
DDGEALFVGRGCSKAVRFTGHDERFQGNRVYALGCDNFFRKCHLAMPSYGFYDLRNGEIV
KVLHDSMRAAAWPVSGMEWFFPLE
Download sequence
Identical sequences K3ZM68
Si027682m|PACid:19707815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]