SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027730m|PACid:19708590 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027730m|PACid:19708590
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily F-box domain 0.000000000981
Family F-box domain 0.0056
Further Details:      
 
Domain Number 2 Region: 143-213,243-312
Classification Level Classification E-value
Superfamily RNI-like 0.0000251
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027730m|PACid:19708590
Sequence length 398
Sequence
MKKTKAAEEGGEDRISELPDALLHQVLSLLPVDEAVQTSVLARRWRGLWKGMPVLRLVGP
KKRFPSAEDFDRFVNRLISVRGDSPLVTCEIEAYLTWDDYAGEPEEPEPNVHFHSWIHCG
RPYRLRNRARRASCLPAPDELGQELDMRHCGFWVRSMSFPSLKRLHLTECNFPEGHRVRV
SAPSIVSLRLHDCRGKTPLFESMPSLETASIDLSHGCKDQCRGGCGDESCEGCHGYPVGS
YQSVLLNSLSNAVNLELKDQPKVYIYKRDLECCPIFGRLMTLLLDMWCRAIDLHALVRIL
QHTPILEKLTLQLRSDENFLSAARGESRKHVRIEQSFACANLKEVNIECEEKLRVKDKVR
QIVKILSKSGIRNEQISVKKIPRPEGCYRWEVVSPRGL
Download sequence
Identical sequences K3ZMB6
Si027730m|PACid:19708590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]