SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027732m|PACid:19708562 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027732m|PACid:19708562
Domain Number 1 Region: 16-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0056
Further Details:      
 
Domain Number 2 Region: 149-236,308-351
Classification Level Classification E-value
Superfamily RNI-like 0.00000004
Family 28-residue LRR 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027732m|PACid:19708562
Sequence length 411
Sequence
MPHRFETAAETSGEDQDLLGALPDEILQHVLSFLPSDEIVPTCLLARRWRDLWKSTPALR
ISDAENRFWDYRDMHEFVNHLLLLRDSEPMDICEINYSRYLGWGVLGKKRPFKYVGTWIR
YALRHKARVLRVIIHKENKHFELDSAPLISQHLTVLELSGVQLDDRALDLSRYPALKDLK
ITECIIVARKISSQSLRHLIVNDNVFGPGLRIQISIPSLVSLHLKGFAGRTPVLESMPLL
ETAHVALGAECDDRCDNSSSGNCGKDTCKGCHDCPDGPERCVLLRGLSNATDLKLIAELN
VFIFKRDLIFCPTFSKLKTLLLFGWSVAVDPSSVVFLLQHSPVLEKLTLQLYKVPEGSQN
PENHYAFAHLKIVEGERREVEESAQNFLKSHYGIPVDLIKIQEPNGSSYSS
Download sequence
Identical sequences K3ZMB8
Si027732m|PACid:19708562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]