SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027738m|PACid:19708237 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027738m|PACid:19708237
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000536
Family F-box domain 0.0055
Further Details:      
 
Domain Number 2 Region: 147-346
Classification Level Classification E-value
Superfamily RNI-like 0.0000102
Family 28-residue LRR 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027738m|PACid:19708237
Sequence length 427
Sequence
MRPEKKSKNVPAASGSDRIDALPDDVLEHIIGFLPVDEAGRTSVLARRWRHLWKYATALR
IRCVEDDACFSHQRGLKHSQDPEAIDGMLRLRGRAPLQVCELTFDCFYKDDDVVRLNRWV
RHVVMCQVQRFRLENFYAAEFMELDNLPLVSRHLTRLELVGLLLNSDFCDFSSCPSLQHL
ELSDCYFRNVKRLSSDSVKWLSMTDCNFSTESSTLILVPSLVSLRLHAHLYRPPILGSMP
LLQEAYVRVPLLDNFPMVCEEENCYSCHDIMDNNKCALLNGLSNAEKLALLSESTTFIFK
SDLKQCPTFSKLKTLLLNDHWCVPPDFSALTCILKNSPVLEMLVLQLFSKEHDHIVEIEG
RYHPMVDRSAVISKDLKAIKIKCEAVDENVHKILKFMCTLNIFMSSNRYFNQTILLVMLN
YVVTKFL
Download sequence
Identical sequences K3ZMC4
Si027738m|PACid:19708237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]