SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027740m|PACid:19707304 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027740m|PACid:19707304
Domain Number 1 Region: 18-71
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000379
Family F-box domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027740m|PACid:19707304
Sequence length 387
Sequence
MSDQTTGHRRQTSPLDDDDLLGEILARVPLQPSSLLRISIVCKRWQRLVSGEWFRHRLCA
HHRKAPLLGYFHLSTIFNDVVFNPIMEPPDRIHPRRFLPGRALPAAGQDIELLGCRHGRV
VFTNISAITVFVCDPVTGGYARLAVPPEFPKLFINGTVLCAAGEQGHVHGACHSSPFKVV
MVSMFTEDRRPMACVYSSDWPIVGSSTLIGHALCWLISSGSQDEDEDGYIPVPYGVLEFD
LDRNILTITKGPPINHMVGWGQIVKTIDGHVGFATLLYQTLGSLQVWHGNVNCSDTADLH
SIFGLQEIRRHGIFGYDEDDNVIFIYSYEGDSRLFMLQLDTMQFKMHYETIGRRYPTMCH
PFRSFYTAAGLNSLEIPTELSQSKPQT
Download sequence
Identical sequences K3ZMC6
Si027740m|PACid:19707304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]