SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027783m|PACid:19707031 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027783m|PACid:19707031
Domain Number 1 Region: 6-44
Classification Level Classification E-value
Superfamily F-box domain 0.00000314
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  Si027783m|PACid:19707031
Domain Number - Region: 170-218
Classification Level Classification E-value
Superfamily RNI-like 0.0785
Family 28-residue LRR 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si027783m|PACid:19707031
Sequence length 249
Sequence
MASTTAASCRCLSDLPDELLQHILGFVPSREAASTAVPRRWRGLWPMPAGAVNLDTRSSG
GEHQAFFRGADAAIAAHGGSVRRLAVHIEDDDGPDSIQDFMSGSSWGKDCHCVNDVLRLP
AIRAVEELSIGASYSNLPAAVAANQRCESAMPDDDEGLYDLSMDSIPSEALRVLRITNCS
DHYTSNNFHRRGPPPATAFQCLEVLQLRRCNISLESLQDMIVATLVLLNCGHQEGVVIEL
DVPRMQQFR
Download sequence
Identical sequences K3ZMG8
Si027783m|PACid:19707031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]