SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027798m|PACid:19706349 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027798m|PACid:19706349
Domain Number 1 Region: 14-53
Classification Level Classification E-value
Superfamily F-box domain 0.000000327
Family F-box domain 0.0086
Further Details:      
 
Weak hits

Sequence:  Si027798m|PACid:19706349
Domain Number - Region: 221-263,313-366
Classification Level Classification E-value
Superfamily RNI-like 0.0785
Family Cyclin A/CDK2-associated p19, Skp2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027798m|PACid:19706349
Sequence length 503
Sequence
MGSDSGAVLAGGGGGGGGDRLSGFGDAVLVHVLSFLPADEAVRAAALSRRWRDVPGYGGP
INRNPGVPTPPVVNTVSAALFCRLRSGGGPAAAVPLRVRFQAFSGLNAGLVDMWLCCAMR
QAGDELHVDLHLRGEVVCRRGYSLRRSVSAAHADKEDGGQEEPASDGGEYDYYNKFGSYG
GDKESDSDADGEDDDDPALPESEPADDSDEEEPPPPYKNDAVQRLVSACPRLADLTLESF
EKLTKLAILGTRLRRLALRCCHDLAAVAADSSELRAFEYRGAVPAPSFLALRGGARKISS
CALDFCGAEATDPPKLARLGDFLRLFVGVKRLQLTSARLGGAGGALAFPAFPKLHHLGLT
GMLPEDDTAAVATVTRVLKRTPSMETLTLFFLPEPEDLEDSDYYYIDEEELLDGHKLKYD
RHAPLAVPEVEILCLRERTKEISFVHYEGNLAQRTLAKFLLRNAPVVDEVCGEFAQGPLR
IQTRLMEEIKGWVVNKSANTMFF
Download sequence
Identical sequences K3ZMI0
Si027798m|PACid:19706349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]