SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027831m|PACid:19707491 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027831m|PACid:19707491
Domain Number 1 Region: 31-69
Classification Level Classification E-value
Superfamily F-box domain 0.0000118
Family F-box domain 0.013
Further Details:      
 
Domain Number 2 Region: 142-338
Classification Level Classification E-value
Superfamily RNI-like 0.0000251
Family 28-residue LRR 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si027831m|PACid:19707491
Sequence length 437
Sequence
DGSNCSASQIMVSPSLEGDISHCVETMGSQVQLPEDILHQIHALMPLRDAAQAACVSRGF
LRSWRCFPNLIISVDSLGINVNTSNDEIKRDFVCRVDHIMQNHSSMGVKRFVIETYPCSN
LQPSYVDRWLQCAITPGIKEIYLSMLSCGIKYNFPGLLLFSREIRSSIQTFVLGDCSFHC
AAQVGYMSSLTNLELHSIPCLLQKLDILDVLGCSKLEMIDTNAPNLSTFFFAGRPIHISL
GEALQVRKISFRRDYSPNALYYASTKFPFIAPNLQTLVLSTSDETVNTPKVFGKFIQLKY
LEIVVSTSTFSQDYDLCSLISFLDASPALESLIVRCLQEQCHDNLKNVMITGFCSAKSMI
ELTICIIEKTKALACLTLDTTRGYDRRHVKVDKCLQLNEEALVEAKKARVAIQRYIEGRV
PPAVNLKVIEPCSKCIW
Download sequence
Identical sequences K3ZML3
Si027831m|PACid:19707491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]