SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027841m|PACid:19708447 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027841m|PACid:19708447
Domain Number 1 Region: 21-89
Classification Level Classification E-value
Superfamily F-box domain 0.000000278
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  Si027841m|PACid:19708447
Domain Number - Region: 131-247
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0101
Family Galactose oxidase, central domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027841m|PACid:19708447
Sequence length 360
Sequence
MVTKPSHPLTTVPPRPPPALIDDVTTEILIRLPPDEPEHLFCAALICKPWFRVLYDPAFL
HRYRATAPLPSSASSPQAPSPRRGPRTPLRLHHVDARLPPPGLRRPPHAPPRLPPRPRAH
PHMLEDRAVDLLVWDPVTGDRHGLREPHIDWMAYSAAVFCAADGCDHLDCHGGPFRVVLV
GTDDAVYKIWASVYSSETGAWSSPTSVRNGGAVYVQPRRGTIVGNEIYFTLSRSTAIVKY
DWDKNCCFISRKVNAEGAAEWLRCRIIDLEKIMPMAKPCDGDGAYLCGWLRRGCGCHLCG
TDVGLFTIELKFERVRKVDEPGVSYSVLPYMSFYTPAIKICRSGLLGLHGSRLDCEQCGN
Download sequence
Identical sequences K3ZMM3
Si027841m|PACid:19708447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]