SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027862m|PACid:19706310 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027862m|PACid:19706310
Domain Number 1 Region: 28-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000327
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si027862m|PACid:19706310
Domain Number - Region: 214-270
Classification Level Classification E-value
Superfamily Kelch motif 0.00785
Family Kelch motif 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027862m|PACid:19706310
Sequence length 333
Sequence
MSSPRKRCRGAFTASPPPPEATTTPASAPALPSDLVLEVVARSDVATLLRCAASCKPLRR
DILNPAFIRRPGRVPGFPANALRPGASSDARRGVPLGEAPRAVRVPRRRRRLRRPPGPLR
ARDVAPRLVVLRRRHADVPRELGICVYDPMNGGRAFLPDPPEMARYSPDDGFSTYVLLTA
SDGIGCSFLLLAADFTMLLYPARSVKVLTVSSPDAGGGEWSPVTSAATHRRSHCSLLHAD
CSAVVLGGAVHWVMYGTGYHLHVLTYDVRAATAGSVELPMDRFPKSYREGNDANLRRRRR
RTGSSPCSSGTGSRSPSGGCCPPAQPPFGRCTP
Download sequence
Identical sequences K3ZMP2
Si027862m|PACid:19706310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]