SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si027983m|PACid:19706410 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si027983m|PACid:19706410
Domain Number 1 Region: 158-373
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000314
Family 28-residue LRR 0.043
Further Details:      
 
Domain Number 2 Region: 18-77
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000101
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si027983m|PACid:19706410
Sequence length 426
Sequence
MELEEAATERALASSGGGSSGVEPDRLSSLPDSLLHAIMSLLKARQAVQTCVLSTRWRHL
WRSVPCLDVDHDEFRTAAGSAPNNHPAPNPDYSDSDLDSYEDSDDENNSISNNDREWEDF
EDFTENLMHRCNISQLDSLRLHVNTSRAPNFADKQAGGWLRRAMKYCNPDPPRQCEGLSS
GSWQLKRLYLCNVALDNRFAKHVSSVCHSLEELELEDCTCEIPAITSRSLKIMVLKNCRW
RYLYEISSPTLKSLVIVGGSNTDDCVLVIVAPVIAHLCLDALIHRGGSRIAIFKSKLSGN
LLKLVCGVSNVKSLELQGFGTMESTPFREFKNLRNLLLDNCDLTDNFHTLGLFLQNSPNL
EKLTLQHCKFLNDSKKKKGTHKPNKPASSQCQSLDVRCENLKLTEIIHKDDDVRQLVELL
LRISGK
Download sequence
Identical sequences K3ZN10
Si027983m|PACid:19706410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]