SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028124m|PACid:19706792 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si028124m|PACid:19706792
Domain Number 1 Region: 53-101
Classification Level Classification E-value
Superfamily F-box domain 0.00000000157
Family F-box domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si028124m|PACid:19706792
Sequence length 232
Sequence
MDISSRAERMNLSCLCNLLFRALAKIFASSTCSLMKTLLQLDEFLHPSPVVAPTAGSELP
WLPQDILMDIFALLETPDLVRAGSVCASWRAAYTSLCATEHCKLQRTPCLLYTSESMGER
AMGLYSLAEKKAYTLTLPDPPIRTREVIALVNPITGDQIALPSVTTIEQVEPIFDDAGTL
CNYEYLWYTGEDWLYDKPSILDLSKLRDKFDKAFLSSDPSTGDYFVVLILLD
Download sequence
Identical sequences K3ZNE7
XP_004980630.1.39314 Si028124m|PACid:19706792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]