SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028167m|PACid:19708827 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si028167m|PACid:19708827
Domain Number 1 Region: 25-80
Classification Level Classification E-value
Superfamily F-box domain 0.000000000523
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si028167m|PACid:19708827
Domain Number - Region: 144-275
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000772
Family Galactose oxidase, central domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si028167m|PACid:19708827
Sequence length 292
Sequence
MASQRVQTSRQGDGESSGASNDGGGVLPRDVLYEILLRVPAWVLCRFRTVCESWCSLLSG
RPFIAAHEAHHRHRDPLFAVTCVFGKAVSSTGGDGEYKVLSLSRASDPPYDTQFCEVLTV
DSHGTWRVAPGPPVAIKTLHRETLVASGVVYRLVDRTIGWTIAAFDLEAEQWRPDLLQGP
ASRNWVVRRSLAEVNSRLAAVSSTDSAFDMWLLMGSGAGPVVQATQSSHIVHRAEVLVPG
GHDGRVAFCLRSPYCRDGTLWMYDPRTKMCTHLADCLTIGVGVYSGNLLRQV
Download sequence
Identical sequences K3ZNI8
Si028167m|PACid:19708827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]