SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028188m|PACid:19707273 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si028188m|PACid:19707273
Domain Number 1 Region: 72-205,252-367
Classification Level Classification E-value
Superfamily RNI-like 1.9e-39
Family Cyclin A/CDK2-associated p19, Skp2 0.019
Further Details:      
 
Weak hits

Sequence:  Si028188m|PACid:19707273
Domain Number - Region: 4-47
Classification Level Classification E-value
Superfamily F-box domain 0.000102
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si028188m|PACid:19707273
Sequence length 386
Sequence
MERETMDVSSENYISHLSDDCLLSIFNKLESELDRNAFGLTCRNWLKVRNIGRKSLTFHC
SFNPTIDKEHARCIPNILARSPCLNRISLAGLAELPDSALNALRMSGSSLQSLSLYCCSG
MTDDGLAQVAIGCPNLVVVELQSCFNITDAGLESLSKGCCALKSLNLGSCMGISDRGVSA
IFSNCSNICTLIITGCRRLSGVGFRGCPITLRYLEAESCMLSPDGLLDVVSGGGLEYLNF
HKLGSSTGLDGLGGLAFAKRLRILNLRMCRYLTDDSVTAIASGCPFLEEWNLAVCHGVHL
PGWSAIRLYCNKLRVLHVNRCRNICDQSLIALGDGCPHLEVLHINGCAKITNNGLAFFTI
SRPHVNLRVDEVMSIGPSIENLFRMQ
Download sequence
Identical sequences K3ZNK9
XP_004978950.1.39314 Si028188m|PACid:19707273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]