SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028212m|PACid:19706955 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si028212m|PACid:19706955
Domain Number - Region: 90-184,211-315
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000902
Family Tricorn protease N-terminal domain 0.044
Further Details:      
 
Domain Number - Region: 28-61
Classification Level Classification E-value
Superfamily F-box domain 0.0575
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si028212m|PACid:19706955
Sequence length 358
Sequence
CSTYCLFVHSDTPRPFLFISGSAEHMAATPQSWSDIPLDLACLVLGRLYAHADRVRFAAV
CPQPAAPSTTCPGASRSASLAATSFATASGSWLVYRRVRCLVLVDPFSGATMTLPDPSDA
HLPDKDLVAALFWSSRSNRVAVCRPGGSTWSVAWNLSLWITDMAFYRGKLFAVDHEEDLL
ALDISVDDKTGDPQVSRIGQAIKVNHFHNPDTFHRMLYLVELRGKLLLVRRMIFHEHAHG
SGQMHTFDGQCEPELVVFKADFRRSRWAKVMNLEDDQALFLGPCSRAVCLPQYDSPGNRF
WFLYKDYYPSWQWDSSSTSGTSDMANNGKFSSPLPTISWNRHGGPADHVGAVWLFPSN
Download sequence
Identical sequences K3ZNN2
Si028212m|PACid:19706955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]