SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028250m|PACid:19708407 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si028250m|PACid:19708407
Domain Number 1 Region: 12-59
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000131
Family F-box domain 0.0053
Further Details:      
 
Weak hits

Sequence:  Si028250m|PACid:19708407
Domain Number - Region: 260-333
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.064
Family Ricin B-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si028250m|PACid:19708407
Sequence length 451
Sequence
METTDTVAAPAALPHDVLEDILGRLPVRSLAASRRVCKVWRDLVDDRRLLLRHLLPHSVR
GLFVTYIDHYRPHFLARPAVDGGPRIRIDGKFSFIAREKPFHWYNILDHCNGLVLDSGDH
FGGSGMYVCNPTTRWWARLPPAPHYNHWRPEQRTFLVFDPAGSPAQWEVLMAPPEPHKET
SKADMEPEKRMMEWPPATWRWSALSSTAMEWEEKVFVREGEAAGTVADLLMHSLDKYEPR
WRYGTYCQGALYMHCRGEYISRLCLSTNKYRVIKSPIDLAECQEGAMSYIGRSGNGVCFA
ALDNMAQLRVWTLNESGDETEWLLKHDSVVFTKYEQRRCDGPWTIDATRDYDSETEDDEE
VSQEDNRDWNSDDDANIIDDTADENDCFRMSVSFLGFHPYKAVIFLCHGGYSAVAYHLNS
TKIQYLGELNPGCYNRGLFDSFVYTPCLIGV
Download sequence
Identical sequences K3ZNS0
Si028250m|PACid:19708407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]