SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028275m|PACid:19706966 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si028275m|PACid:19706966
Domain Number 1 Region: 7-61
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000471
Family F-box domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si028275m|PACid:19706966
Sequence length 199
Sequence
METHAAMARALPDDLLADVLARLPLRSLAVSQCICKAWRALTDEHRLLLPRWVRSLFIHY
GDYRRPHFFARPAASPEDGPRIDRKSFVSSRDGGAVQRHGGDARVQPHHAAVGAPAAVPN
RAFLVFDPAALLDYKVLLEPLEPKEDGVEEKDACRSTEWPPSPVGMDVARVLVEDRDVGG
EGCSDKRMASACTARGIEC
Download sequence
Identical sequences K3ZNU5
Si028275m|PACid:19706966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]