SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028289m|PACid:19707721 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si028289m|PACid:19707721
Domain Number 1 Region: 64-112
Classification Level Classification E-value
Superfamily F-box domain 0.0000305
Family F-box domain 0.011
Further Details:      
 
Weak hits

Sequence:  Si028289m|PACid:19707721
Domain Number - Region: 296-378
Classification Level Classification E-value
Superfamily YWTD domain 0.0575
Family YWTD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si028289m|PACid:19707721
Sequence length 397
Sequence
MASMDSGADNAGGESCLSSSTAYPFEYGCGFQQGRVFLFAGDVFDGTPQNQKRPRFDMGR
EPPPPPPQASTWASVHTDILGVVLNFLPCAADRAAVRSVSRHWRAAARGHCLPPPLPVLV
LPKFRFSCLSSRGAMTAPRVPGCPRTRRAMTTVAAGEFVNNGNGECFLVNAFSDGVIHLP
RLKANCNASIYSKSIRIVNDNDSGFVHTASGKKYGMLLCNNAVLSATPNSGSKCIDEHGV
NVSCVSSHVIYPLLRSKHNYSLRFQMVVWRGKLLLIIRNFDARKIEPEIVKVEVFALDIS
TSRVTEIHSFDGDCIFVGNRSCKSFSAGLHVGVQGDLIYFADGYDGVFSYKNRLFDGYMV
CNIRDGTIRPLAVEFSPTNSGAPEVHLDIPVWFCPSE
Download sequence
Identical sequences K3ZNV9
Si028289m|PACid:19707721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]