SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si028375m|PACid:19706607 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si028375m|PACid:19706607
Domain Number 1 Region: 31-84
Classification Level Classification E-value
Superfamily F-box domain 0.0000000432
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si028375m|PACid:19706607
Sequence length 441
Sequence
DVATQATPCPCVHGRAAAGGNDDAGAAALPLPSDLVLEIVARSDAATLVRCAACCKPLRR
DILSPAFIRRVCRGPGAVVPPRLLGFLQSLIMPAASQTSSPPASFSLAHPATPAAACLSE
KHLAPFLPGAGGGGLLARYDPVTSRGGLVVLRRHHYADESGICVYDPMTGGRTFLPDPPE
MAKFSSLSCYFAYVLLTASDGIGCSFLLLAADLSPSSRSVEVRTAAVVIGGAVHWAIRGG
DGDLYHILTYNVRTATAGSIKLPMNRLPKSYDDMNSYDANLRLASSPDGRLTMLVRDKLR
IFVWLLSAGAGWARHAVIDTEAALLRFLMPLPPKPWLQHQQTIQLMSSWERSGMVLFDLV
DGEDDLIALDVETKEMHRVNGRRLMPFMPFEARLRRRPAKDAGGGGAAQARGTAAVSSGH
GTAWGQEVVAGSAARRGRAGA
Download sequence
Identical sequences K3ZP45
Si028375m|PACid:19706607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]