SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029498m|PACid:19711842 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029498m|PACid:19711842
Domain Number 1 Region: 17-78
Classification Level Classification E-value
Superfamily F-box domain 0.000000000549
Family F-box domain 0.0068
Further Details:      
 
Domain Number 2 Region: 181-407
Classification Level Classification E-value
Superfamily RNI-like 0.00000589
Family Cyclin A/CDK2-associated p19, Skp2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si029498m|PACid:19711842
Sequence length 520
Sequence
MEQSGSEIAAKRVKPSDGAAAAAGEDLLSALPDDVLVLILLRLGTAAAVQTSSLSRRWRR
VWALLPELRFHLAPDGPRIRELLDAPEAPELRCVSVTTEDAAPHSAAAWLPVAARRLSGD
LVYHNVVRGNHVDEDDDDDDGDEEEAEEAGVRGDVQLPCFGKAIKIVLNLGFLSLALPSM
GIFPRLTKLSLSRVRFRGPCELGNLVSSPRCPCLQKLKVHDSRGLHNLSIHSESLLQIKL
ESLYSLQQLTIVAPALLGLAVTFSFIDDDPSKPIANISAPQLVSLTWRDLYDPRYVHLGN
LGRLQKLNSFFIVYGQHASRDKNQYCLRLLQQFQVIHSLKLMLVYRKDIDDFQYLMGDMK
MLPQITFLQLAVSNEGHAFGASSFHLLRMCTGLRRLVFVLHDNRNLEAQSTCPSGCICDQ
PTSWKTEGLVLNHLEHVTIFGLQGAEREVTFVKQLFSWAMVLKNIRITFDYQVTESKARD
FCQALAGFSRPETSVEFHLFRDADKRSVYLLAPEGQGTDL
Download sequence
Identical sequences K3ZSB8
Si029498m|PACid:19711842 XP_014660226.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]