SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029559m|PACid:19713576 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029559m|PACid:19713576
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily F-box domain 0.0000000144
Family F-box domain 0.0057
Further Details:      
 
Domain Number 2 Region: 177-310
Classification Level Classification E-value
Superfamily RNI-like 0.000000126
Family 28-residue LRR 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si029559m|PACid:19713576
Sequence length 507
Sequence
MNPDGGACRECRDNQLISPCCRAGLLRRSPRTRRRTEGADHISALPDDLRLKIVSHLDCA
RAAASMSLLSSNWKGLWRRLPKLDFHNIAPDPLIAALHQVVGPAGSLNIYLQIHHKLSAA
GVSSILRAAAPVKPANLHAVFFMDEHADTSVPIELPVFDRATSIKLSFPPLETTLLPTGD
FTKLETLYLIFCNIDLGGLLPCCPKLRKLKISCGPLDSIKVHSNSLEELDVYTLSNLRVV
DIVTPKLKKLRFASNEGTEDEFSLSFSAPLLDDLSWQWWCPSSFGALWRLWSLKLKTVEP
HGRTHLASNGESSCLQLQQRPHDNILLLKMGRSRYARNVFRSFGCDISRIPLDITTGRHV
YGAVVLEVLRFCTSIQRLKIVLNRRQERKRRGTCPASCPCDQPRNWRSQSITLINLKEVE
VEGFSGDDHEVDLLKVITRRATMLEGVTLKFYQKFSLECSAFKEIPSILIAHPSVKFNIF
NYYHVQESSMNDSDSEIVEDTSSDEDD
Download sequence
Identical sequences K3ZSH9
Si029559m|PACid:19713576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]