SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029639m|PACid:19711600 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029639m|PACid:19711600
Domain Number 1 Region: 16-74
Classification Level Classification E-value
Superfamily F-box domain 0.0000000955
Family F-box domain 0.0065
Further Details:      
 
Weak hits

Sequence:  Si029639m|PACid:19711600
Domain Number - Region: 163-269
Classification Level Classification E-value
Superfamily RNI-like 0.00051
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si029639m|PACid:19711600
Sequence length 490
Sequence
MADGEGDAGLRRLAPGEDSISALPDELIQAILACLPSTAAAARTSAVSRRLRRVWTGVPA
LSFQVEEQRPLRAYSSTADAVDAALGAYSASATLNRLTIDVVGASPPASRIDPWLRFASL
RLAGELRLSMAGVPFKQTTLLMFMQPMIPMVSHMQQLELPACERATRIDLAGINFALNLP
AAGAFTALRVLRINVAQLVRGDVGHLVSTQCPRLRELEMCDVATVTAGLSISSASLERLV
LRRASLGMKGRIDVAAPRLYYLALDNCGNRSAAATITTTMLAELIWNHAYKPSHHSLEGA
DRQIYRLVATCGSNSAALFKRFDAVDELCLRLSMPSKEDEYKKFLQDLDKLPKTRVLEVK
GVSTKRHLEPTMMHLLRKHSRLTNIKVDLFQANSKEIECPPVCSCIPPESWTTDDVVLDS
LEEVEISSFTGAPEDIELLKLLFRCKIMIRRLTIHTMSGISLSYEMQKHIWGLARPHCIN
LEFETRQFWS
Download sequence
Identical sequences K3ZSQ9
Si029639m|PACid:19711600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]