SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029730m|PACid:19713388 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029730m|PACid:19713388
Domain Number 1 Region: 23-76,123-157
Classification Level Classification E-value
Superfamily F-box domain 0.00000000222
Family F-box domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si029730m|PACid:19713388
Sequence length 471
Sequence
MGKGKRRNKSTAKQRRAALPAAQTTVHDLPDELVCQVLLGLGSPLDLIRAAATCVRWRRA
IAGEGFLGRFYDHHGAPCVAGHYYVTDTQPPDVTGVLRWPPRKPSAAFVPSSSPDVVDGG
LFSLDFLYVPPVTDRPRRMYYGRRPRRTRIRHNQCREIVDSRGSLLLLTNGPWRELVHPR
HWSSDFIVCEPVSRRYQGIARPADLSHLPLLGAFLLDGGGAGGGDTMSSFRVLSVLYEPD
RSRYQFGMPRACVFAPGSDGGWHICWHTMDDEDVEVPLMEMIHLAGRTAGRVYWGIEDGT
VLVLEESTVKFSLLTFPVQMRGPYRRTSFRVIGSSVDGEDRVRVVRVHGEDLEVFGQLLD
SGEWVVEKSVALRDATAGLSGWDYRFFWLPARIVTAGNTFVVLTPAEKIWLFSVELETME
VENEHVRNRNIGPSYPCALPWPPLLRACVRRGDDDAVVSKRRQRHSKGTTV
Download sequence
Identical sequences K3ZT00
XP_004959374.1.39314 Si029730m|PACid:19713388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]