SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029757m|PACid:19711256 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029757m|PACid:19711256
Domain Number 1 Region: 83-140
Classification Level Classification E-value
Superfamily F-box domain 0.00000000262
Family F-box domain 0.008
Further Details:      
 
Weak hits

Sequence:  Si029757m|PACid:19711256
Domain Number - Region: 190-341
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000131
Family Galactose oxidase, central domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si029757m|PACid:19711256
Sequence length 465
Sequence
MDRLRSILFFFCHATSVRAEAFRPTSHLFLGPSKTHPAQRGEDFVSPGRSAATSLSPAKS
SLRSAGAPTAPQMDPAAALWAMDELVEHILLRCPADDPARLVRAALVCKRWCRILAGAGF
RRRFRELHGSPPMLGFLHRSFPFPPRDGAQCGFASTTSFRATNADLGGRHALDSRHGRVL
IGRLPKVGDHSDSRLAVWDPITGEQLELPEPPPCRGRPLLNWNAAVLCASSQDGACDHLD
CHRGHFLVVVVGTNILVHFAIVYSSEDGAWSKPTYAFQPDDTIVHLEESEPSILAGNALY
FISANETDLRSRILKYDLGTSMFDTIRLPPSTSRYRKSVMLTATENGGLGCGIVEHSRLC
LWSRVAGRPNEHWVWAQTRVIELEKIIPDDDILMSYHLAGYAHGLDVLFIMRFDGLFSVD
LKSGRMKRVCRREGIYGVVPYMSFCTPALRVISTGEGPSAGVSSA
Download sequence
Identical sequences K3ZT27
Si029757m|PACid:19711256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]