SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029776m|PACid:19709301 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029776m|PACid:19709301
Domain Number 1 Region: 21-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000000089
Family F-box domain 0.0073
Further Details:      
 
Domain Number 2 Region: 239-424
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.000000131
Family Thermostable phytase (3-phytase) 0.028
Further Details:      
 
Weak hits

Sequence:  Si029776m|PACid:19709301
Domain Number - Region: 162-271
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0675
Family Methylmalonyl-CoA epimerase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si029776m|PACid:19709301
Sequence length 461
Sequence
MDGHGSKLRAAAAAAAASGTRVPDDALVEMFELLPAKSLHRFKCVSKAWCGLVTDPLHRV
RFAQTLAGFLCADVTDDDTAAAGTEIGGVCERCREDGGGDGAESSHRTCPHAAVSNRVIT
RRFINVSRMAAPLIDATFPFLPPAPPTGEGFRDVIVDARDGLVLLARVRRHESPDLHPPA
CYLVCNPATARWAAVPPSGWAPTTTSQPVARTYLLFDAASSPHAFHLLQFRLDEMDAVRA
VHTYSSAEGAWTDRAGPWRDGGWRDWGRAVAPIQPGTGAAVANGMLHLVVDTDGTTGPNN
LVAVDEEGNTRRTIPLPRREVAEKDWHSVFVARSQGRLHYVMCVRPPHGRLSEEHPLKLL
VWVLEDHDAGEWVLKHTVSFPELFGRIACQFRVEYSVVAVHPDGNWVFFVRHWDRKLVAY
DMDRREVIVVADLGAGGEVGDELPTPYVPLYSKCSALTNIQ
Download sequence
Identical sequences K3ZT46
XP_004955706.1.39314 Si029776m|PACid:19709301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]