SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029792m|PACid:19713155 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029792m|PACid:19713155
Domain Number 1 Region: 398-453
Classification Level Classification E-value
Superfamily GYF domain 1.11e-17
Family GYF domain 0.00061
Further Details:      
 
Domain Number 2 Region: 20-74
Classification Level Classification E-value
Superfamily F-box domain 0.000000000628
Family F-box domain 0.0089
Further Details:      
 
Weak hits

Sequence:  Si029792m|PACid:19713155
Domain Number - Region: 96-207
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0275
Family Galactose oxidase, central domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si029792m|PACid:19713155
Sequence length 457
Sequence
MAGPEPIGHRPWLSSPLDDDDPLSEILRRLPPRPSSLPQASLVCKRWRDLAASPQFLRDF
RVFHRAAAPLLGFFHNTNLGGPDRRFVAAADPPDRVPAALFRMPCGRNHKEWKFLDCRHG
RVLLIGSVGPRREVLVWDPMTGARRCTPVPPDAGDVRQGAVLCSCGLARDCRSSPFRVVL
VWWIGTTQHWRVAAAIYSSESDAWSHVISVETQLAPTVLVTQRNARKPGVLVGDAVYWLL
PESRILEFDTVRRSLSLISGPVHSAGSPYWQSHLVLTEVKELGYAMFMVTEVSIKLWKRD
TGNAAGWSMHRSVRLDKCLPRMPMQAKPSLLGFHEESNAIFVWINAGLFLIQLESMQSRM
LCQGVGDFEIYPFSGFYHRDAAGTQADDACSHALPIATLTMWHYEDPQGDLHGPFSMAML
HSWRSNGFFPEDLRVWRTDETKEQAVLLTDAMRMPCY
Download sequence
Identical sequences K3ZT62
Si029792m|PACid:19713155 XP_004957842.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]