SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029804m|PACid:19709830 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029804m|PACid:19709830
Domain Number 1 Region: 30-91
Classification Level Classification E-value
Superfamily F-box domain 0.00000000638
Family F-box domain 0.0037
Further Details:      
 
Weak hits

Sequence:  Si029804m|PACid:19709830
Domain Number - Region: 164-268,357-417
Classification Level Classification E-value
Superfamily RNI-like 0.0255
Family 28-residue LRR 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si029804m|PACid:19709830
Sequence length 454
Sequence
MQLRSGRRLVPSRPSAAPQGGARRGCPRRRPEEGDGGGEDRLSGLPEELILEVLDRLGCA
REAARTSGLSRRWRGLWTHLPVLTFDGMNPDSLGGALARVRPERNRLVIRIYPGATLSAA
RVSSLLNASARIAPKELVVELDRYSRGVRVKLPRLIQNLASALSEAGKFAALESLALVPC
CVDPSDLLPLCPCLRRFEAQCHYNWTLDTLEVHSESLEELVLGIQHRSSMPQHVNIATPM
LKKFMLRSYGFRFAMSFLAPKVEEFSLEMECGLSRVGFGEKWHLLWLSMATAWTNRYGQF
PRVRVHTLSLTIAARDRYSAAAQSFAQEIARLPVSHFSVLELRLRTEGRGFGALFGECLK
NFDCDQASNWRNEHISLPNLQVVEFEGFHGADHEVDFLKFLFQSAPMLKRLTIELSAEIS
PDIQGCQELCSILKANASVKCYVYDRSGQKISFA
Download sequence
Identical sequences K3ZT74
Si029804m|PACid:19709830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]