SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029893m|PACid:19711308 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029893m|PACid:19711308
Domain Number 1 Region: 25-69
Classification Level Classification E-value
Superfamily F-box domain 0.000000000068
Family F-box domain 0.0082
Further Details:      
 
Weak hits

Sequence:  Si029893m|PACid:19711308
Domain Number - Region: 141-311
Classification Level Classification E-value
Superfamily RNI-like 0.000133
Family Rna1p (RanGAP1), N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si029893m|PACid:19711308
Sequence length 434
Sequence
MAMPAGAKRERRARLDEDGKEELVDRISRLPDDVLGNIVSFLPTKDGARTQVLSSRWRPI
WRSAPLNLEISIAYVSRILSAHQGPGRRFCTQFPYLDPSDRSATLDRWLRSPALNSLQVL
EFHLGSPLQNPPLPASVHLFSSTLRAASFGCCAFPEGNSASPLHLPLLKQLSLFDVRISE
TSFNALLAACPTLQSLLLTNISGCSRVQIVSQNLRSIGFLRTFYRDGHTSLQQLIIKDAP
YLERLLCFENGSGMEVTVVSAPQLHRSCIPSSTTVVHSMKVLALTQPDLCLDMVINLLKC
FPCLEKLYIETQKAGKKNTWCHKYKNLIGTIEIHLKKIVLTNYRGNTSHVNFAKFFVLNA
RMLQSMRFELFDQNPSTAWIEKQHGLLQIKKASRVIQFDFVAKNSCSLMLSIEFAGQVHD
LLTADPFVKLHNWT
Download sequence
Identical sequences K3ZTG3
Si029893m|PACid:19711308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]