SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029925m|PACid:19711017 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029925m|PACid:19711017
Domain Number 1 Region: 22-83
Classification Level Classification E-value
Superfamily F-box domain 0.000000000484
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 227-263,311-402
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000106
Family Galactose oxidase, central domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si029925m|PACid:19711017
Sequence length 428
Sequence
MAAAVETSGGGCGRKRKRAASGLADLHDDMLERVLARLPPASYFRLRGVSRRWRAAAEST
TFRAACARVPPRDPWFLMLEDSGIQGQEEHQQQLPPRPAVVFDSAERAWARWRGAPGPAV
PVAAAGGLVLYRDAATAELTVVNPLTGASRALPQPPPAASAAGALQAVAMYGSPYRVVLI
LGELPDLSMALYDSTKNAWEGAVALTRKAEGDDEASSRERVAEEGDGGGDDTVYFLSKSG
DVVATTTQRSASRQYSSAVACRGGGGGGGGGEDVVAYFLSRSGSVVACDLARRAFAELPR
ILPVYHEYSIDVVACGGAAYAVVLSEFLDTASLRVWEHAGGSWRQVAAMPPAMSHAFRGT
KADVNCVGHGDRVIVCVSSGDAGASGCFMCDVRSNRWEELPPRAGGGEEASTGFVAALSF
EPRMEAAV
Download sequence
Identical sequences K3ZTJ5
Si029925m|PACid:19711017 XP_004958318.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]