SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029942m|PACid:19710686 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029942m|PACid:19710686
Domain Number 1 Region: 78-294
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000471
Family Cyclin A/CDK2-associated p19, Skp2 0.036
Further Details:      
 
Domain Number 2 Region: 5-43
Classification Level Classification E-value
Superfamily F-box domain 0.000000000955
Family F-box domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si029942m|PACid:19710686
Sequence length 423
Sequence
MECGETGMNSVPDGVVQHILSMLSNVRDVAACACVCRRWRDCVPYLPALFFPRNAFDAAA
VGRGAADDTIGRMVASVARLRELVIYCPFSMERLPAWLAARSATLRVLELRMDAAAEKAA
EGGQLDCIGLVANLEELRLWGVSLTAAPAWGRMERLRVLEVVGAPLRDSAVRDAIAACPN
LTDLSMLGCDCSGTVALDLHLLVRCRLDILGAGNCSLLITAPRLESLEVHGFTWITLRGH
SLRRLSIAKSTGRVHMVDTGKLPDLEHLSLRGVQWNWAAVSSVLQCASEVKHLVMKIEFC
GDLDALQPFPEVDLVDFFNSHPKLRKFEIHGAMFAAMCQKNSLKNLDSRFLIPCLEEVLI
TVRSPLNAEQKLNTLESLVKYSLKLRTMVIRISQMKNCHEAADEFFEEICKFKYMNYKKV
RIE
Download sequence
Identical sequences K3ZTL2
XP_004957001.1.39314 Si029942m|PACid:19710686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]