SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029948m|PACid:19709177 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029948m|PACid:19709177
Domain Number 1 Region: 20-77
Classification Level Classification E-value
Superfamily F-box domain 0.000000000942
Family F-box domain 0.0064
Further Details:      
 
Weak hits

Sequence:  Si029948m|PACid:19709177
Domain Number - Region: 203-296
Classification Level Classification E-value
Superfamily L domain-like 0.00116
Family Ngr ectodomain-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si029948m|PACid:19709177
Sequence length 419
Sequence
MGRPSGSTRKEARIADGAGADRFTALPIELRAHIVSFLPYREIVQLSVLSRPWMHIHHYT
PVVKLNLDEFLFFDDIMLDEGDEDALPGVVDDGLLVGLRVALRRRAQEGSGCTVDALRIA
YAVDDRRMRRHADRIIALVDARRIRVTVPYNGRTSRDAWTLALPAAARYLDVAVFGHLSP
AITGPGAAALLNLRLEHVVLREWPCLPSLRSLTLNTVTVEAPLPPGAWSPLLEYLSIFNS
KIEQARVDIRLPLLKSLDLDLVDVSAHGDSIGSPFGDITVDAPRLEDLEVICIAGCAAEY
KSFTLRAPMLRYLYWHNQFAERVAIDVGSPGSVTAGKIQFEWNHESSCRELKSYKAQMMR
MLEGLIPELSPERVAHAARPHMTLDKYTVEGTDFVEDGKMIPEERLACDLDAIMSSLKD
Download sequence
Identical sequences K3ZTL8
Si029948m|PACid:19709177 XP_004955868.2.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]